PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT4G26640.1
Common NameAtWRKY20, T15N24.90, WRKY20
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family WRKY
Protein Properties Length: 485aa    MW: 53601.5 Da    PI: 7.1021
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT4G26640.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY100.88.4e-32139196260
                  --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
         WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                  dDgynWrKYGqK+vkgsefprsYY+Ct+++C+vkk  ers+ d+++++i+Y+g+H+h+k
  AT4G26640.1 139 DDGYNWRKYGQKHVKGSEFPRSYYKCTHPNCEVKKLFERSH-DGQITDIIYKGTHDHPK 196
                  8****************************************.***************85 PP

2WRKY104.74.9e-33308366159
                  ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
         WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                  ldDgy+WrKYGqK+v+g+++prsYY+Ct +gCpv+k+ver+++dpk+v++tYeg+H+h+
  AT4G26640.1 308 LDDGYRWRKYGQKVVRGNPNPRSYYKCTAHGCPVRKHVERASHDPKAVITTYEGKHDHD 366
                  59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081123.388133197IPR003657WRKY domain
SuperFamilySSF1182906.41E-25136197IPR003657WRKY domain
Gene3DG3DSA:2.20.25.805.7E-27137197IPR003657WRKY domain
SMARTSM007748.5E-34138196IPR003657WRKY domain
PfamPF031062.0E-24139195IPR003657WRKY domain
Gene3DG3DSA:2.20.25.806.4E-37293368IPR003657WRKY domain
SuperFamilySSF1182905.1E-29300368IPR003657WRKY domain
PROSITE profilePS5081138.205303368IPR003657WRKY domain
SMARTSM007747.7E-38308367IPR003657WRKY domain
PfamPF031062.4E-25309365IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009611Biological Processresponse to wounding
GO:0009961Biological Processresponse to 1-aminocyclopropane-1-carboxylic acid
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 485 aa     Download sequence    Send to blast
MILLPEPSPT TGSLFKPRPV HISASSSSYT GRGFHQNTFT EQKSSEFEFR PPASNMVYAE  60
LGKIRSEPPV HFQGQGHGSS HSPSSISDAA GSSSELSRPT PPCQMTPTSS DIPAGSDQEE  120
SIQTSQNDSR GSTPSILADD GYNWRKYGQK HVKGSEFPRS YYKCTHPNCE VKKLFERSHD  180
GQITDIIYKG THDHPKPQPG RRNSGGMAAQ EERLDKYPSS TGRDEKGSGV YNLSNPNEQT  240
GNPEVPPISA SDDGGEAAAS NRNKDEPDDD DPFSKRRRME GAMEITPLVK PIREPRVVVQ  300
TLSEVDILDD GYRWRKYGQK VVRGNPNPRS YYKCTAHGCP VRKHVERASH DPKAVITTYE  360
GKHDHDVPTS KSSSNHEIQP RFRPDETDTI SLNLGVGISS DGPNHASNEH QHQNQQLVNQ  420
THPNGVNFRF VHASPMSSYY ASLNSGMNQY GQRETKNETQ NGDISSLNNS SYPYPPNMGR  480
VQSGP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A3e-36137368877Probable WRKY transcription factor 4
1wj2_A3e-36137368877Probable WRKY transcription factor 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.33750.0flower| root
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible253983_at0.0
Expression AtlasAT4G26640-
AtGenExpressAT4G26640-
ATTED-IIAT4G26640-
Functional Description ? help Back to Top
Source Description
TAIRmember of WRKY Transcription Factor; Group I
UniProtTranscription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00455DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT4G26640.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Interaction ? help Back to Top
Source Intact With
IntActSearch Q93WV0
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT4G26640
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY1504360.0AY150436.1 Arabidopsis thaliana unknown protein (At4g26640) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_567752.10.0putative WRKY transcription factor 20
SwissprotQ93WV00.0WRK20_ARATH; Probable WRKY transcription factor 20
TrEMBLQ6H9420.0Q6H942_ARATH; At4g26640
STRINGAT4G26640.20.0(Arabidopsis thaliana)
Publications ? help Back to Top
  1. Eulgem T,Rushton PJ,Robatzek S,Somssich IE
    The WRKY superfamily of plant transcription factors.
    Trends Plant Sci., 2000. 5(5): p. 199-206
    [PMID:10785665]
  2. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  3. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  4. Hoth S, et al.
    Monitoring genome-wide changes in gene expression in response to endogenous cytokinin reveals targets in Arabidopsis thaliana.
    FEBS Lett., 2003. 554(3): p. 373-80
    [PMID:14623097]
  5. Gong W, et al.
    Genome-wide ORFeome cloning and analysis of Arabidopsis transcription factor genes.
    Plant Physiol., 2004. 135(2): p. 773-82
    [PMID:15208423]
  6. Andersson-Gunner
    Biosynthesis of cellulose-enriched tension wood in Populus: global analysis of transcripts and metabolites identifies biochemical and developmental regulators in secondary wall biosynthesis.
    Plant J., 2006. 45(2): p. 144-65
    [PMID:16367961]
  7. Proietti S, et al.
    Cross activity of orthologous WRKY transcription factors in wheat and Arabidopsis.
    J. Exp. Bot., 2011. 62(6): p. 1975-90
    [PMID:21193575]
  8. Arabidopsis Interactome Mapping Consortium
    Evidence for network evolution in an Arabidopsis interactome map.
    Science, 2011. 333(6042): p. 601-7
    [PMID:21798944]
  9. Luo X, et al.
    Expression of wild soybean WRKY20 in Arabidopsis enhances drought tolerance and regulates ABA signalling.
    J. Exp. Bot., 2013. 64(8): p. 2155-69
    [PMID:23606412]